PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000335.1_g00025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 260aa    MW: 29485 Da    PI: 5.452
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000335.1_g00025.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM133.31.7e-4181392128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpk...kvka.eekewyfFskrdkkyatgkrknratksgy 82 
                              ppG+rF Pt+eelv++yLk+k+eg+  e  +v i+ ++iy+++Pw+Lp+   k++  + ++w+fF++ ++++a+g r++r t+ gy
  Itr_sc000335.1_g00025.1   8 PPGYRFFPTEEELVSFYLKHKLEGRFQEHIDVvIPVLNIYDHDPWSLPQfagKYNRsDPEQWFFFIPMQEREARGGRPTRLTAGGY 93 
                              89**********************9977666669999***********646633332556************************** PP

                      NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              Wkatg+   v+s +++++g k+t+vfy+grap+g+kt+W m+eyr+
  Itr_sc000335.1_g00025.1  94 WKATGSPGLVYSGNNRVIGGKRTMVFYTGRAPNGRKTEWKMNEYRF 139
                              ********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-477159IPR003441NAC domain
PROSITE profilePS5100548.5847159IPR003441NAC domain
PfamPF023652.0E-218138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MEEEDFPPPG YRFFPTEEEL VSFYLKHKLE GRFQEHIDVV IPVLNIYDHD PWSLPQFAGK  60
YNRSDPEQWF FFIPMQEREA RGGRPTRLTA GGYWKATGSP GLVYSGNNRV IGGKRTMVFY  120
TGRAPNGRKT EWKMNEYRFT ERETSNSPQE FILCRVYKKP KCARAFDRRP ACVAPAAPPA  180
ADGGELLALQ PPPPPQMAAA ANDASASTSQ QKAEADKKSS SQETSSPSPP HGGDNVEDEP  240
VWDFSDMILW EWDPFKVLYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-33816421173NAC domain-containing protein 19
3swp_C3e-33816421173NAC domain-containing protein 19
3swp_B3e-33816421173NAC domain-containing protein 19
3swp_A3e-33816421173NAC domain-containing protein 19
3swm_D3e-33816421173NAC domain-containing protein 19
3swm_C3e-33816421173NAC domain-containing protein 19
3swm_B3e-33816421173NAC domain-containing protein 19
3swm_A3e-33816421173NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801687.14e-84PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR34e-68NAC90_ARATH; NAC domain-containing protein 90
TrEMBLR4NFV01e-79R4NFV0_JATCU; NAC transcription factor 038
STRINGPOPTR_0016s07690.14e-78(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.13e-67NAC domain containing protein 90